>NP_005441.1 noggin precursor [H.sapiens]
MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPL VDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPED RPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGL AQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRY VKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRC GWIPIQYPIISECKCSC

quickGene

Sequence based search of
Entrez Gene data

Homo sapiens 100.0% NOG
Rattus norvegicus 99.14% Nog
Mus musculus 99.14% Nog
Gallus gallus 82.59% NOG
Xenopus laevis 78.13% nog-A
other quickApps
quickImage
quickLit Expression of a Xenopus homolog of Brachyury (T) is an immediate-early response to mesoderm induction Cell 67 (1), 79-87 (1991) Smith, J.C., Price, B.M., Green, J.B., Weigel, D. and Herrmann, B.G.